HPE0-J77 Related Links

HPE0-J77 Issu  |   HPE0-J77 Dropmark  |   HPE0-J77 Wordpress  |   HPE0-J77 weSRCH  |   HPE0-J77 Scribd  |   HPE0-J77 Youtube  |   HPE0-J77 Vimeo  |   HPE0-J77 Dropmark-Text  |   HPE0-J77 Blogspot  |   HPE0-J77 RSS Feed  |   HPE0-J77 publitas.com  |   HPE0-J77 Google+  |  
Download Latest Pass4sure HPE0-J77 Questions - brothelowner

real test HPE0-J77 Q and A.

HPE0-J77 exam questions | HPE0-J77 free exam papers | HPE0-J77 quest bars | HPE0-J77 study questions | HPE0-J77 bootcamp - brothelowner.com



HPE0-J77 - Designing HPE Backup Solutions - Dump Information

Vendor : HP
Exam Code : HPE0-J77
Exam Name : Designing HPE Backup Solutions
Questions and Answers : 50 Q & A
Updated On : December 15, 2017
PDF Download Mirror : [HPE0-J77 Download Mirror]
Get Full Version : Pass4sure HPE0-J77 Full Version

Review HPE0-J77 real question and answers before you take test


killexams.com helps a great many applicants pass the exams and get their certifications. We have a huge number of effective surveys. Our dumps are solid, reasonable, updated and of truly best quality to conquer the troubles of any IT accreditations. killexams.com exam dumps are most recent updated in exceedingly outflank way on customary premise and material is discharged intermittently. Most recent killexams.com dumps are accessible in testing focuses with whom we are keeping up our relationship to get most recent material.

The killexams.com exam questions for HPE0-J77 Designing HPE Backup Solutions exam is basically in view of two available arrangements, PDF and Practice software. PDF record conveys all the exam questions, answers which makes your planning less hardworking. While the Practice software are the complimentary element in the exam item. Which serves to self-survey your advance. The assessment apparatus additionally features your feeble regions, where you have to put more endeavors with the goal that you can enhance every one of your worries.

Killexams.com prescribe you to must attempt its free demo, you will see the natural UI and furthermore you will think that its simple to alter the readiness mode. In any case, ensure that, the real HPE0-J77 item has a larger number of highlights than the trial form. On the off chance that, you are placated with its demo then you can buy the real HPE0-J77 exam item. killexams.com offers you three months free updates of HPE0-J77 Designing HPE Backup Solutions exam questions. Our master group is constantly accessible at back end who updates the substance as and when required.

Killexams.com Huge Discount Coupons and Promo Codes are as under;
WC2017 : 60% Discount Coupon for all exams on website
PROF17 : 10% Discount Coupon for Orders greater than $69
DEAL17 : 15% Discount Coupon for Orders greater than $99
DECSPECIAL : 10% Special Discount Coupon for All Orders



HPE0-J77 Discount Coupon, HPE0-J77 Promo Code, HPE0-J77 vce, Free HPE0-J77 vce, Download Free HPE0-J77 dumps, Free HPE0-J77 braindumps, pass4sure HPE0-J77, HPE0-J77 practice test, HPE0-J77 practice exam, killexams.com HPE0-J77, HPE0-J77 real questions, HPE0-J77 actual test, HPE0-J77 PDF download, Pass4sure HPE0-J77 Download, HPE0-J77 help, HPE0-J77 examcollection, Passleader HPE0-J77, exam-labs HPE0-J77, Justcertify HPE0-J77, certqueen HPE0-J77, HPE0-J77 testking

View Full Exam »



That changed into remarkable! I got actual questions of HPE0-J77 examination.

i am one some of the high achiever inside the HPE0-J77 examination. What a super Q&a fabric they supplied. within a short time I grasped the entirety on all of the applicable topics. It become genuinely tremendous! I suffered loads whilst making ready for my preceding attempt, however this time I cleared my examination very without problems without tension and concerns. it's far virtually admirable learning journey for me. thank you loads killexams.com for the real help.

amazed to look HPE0-J77 dumps and examine guide!

I skip in my HPE0-J77 exam and that was now not a easy bypass however a terrific one which I should inform all of us with proud steam filled in my lungs as I had got 89% marks in my HPE0-J77 exam from studying from killexams.com.

Get high scores in little time for coaching.

today i am very happy because i've were given a very excessive rating in my HPE0-J77 exam. I couldnt suppose i'd be capable of do it however this killexams.com made me assume in any other case. the web educators are doing their process very well and that i salute them for their determination and devotion.

much less effort, tremendous information, guaranteed achievement.

Knowing very well about my time constraint, started searching for an easy way out before the HPE0-J77 exam. After a long searh, found the question and answers by killexams.com which really made my day. Presenting all probable questions with their short and pointed answers helped grasp topics in a short time and felt happy to secure good marks in the exam. The materials are also easy to memorise. I am impressed and satiated with my results.

where can i get assist to bypass HPE0-J77 examination?

just surpassed the HPE0-J77 exam with this braindump. i can affirm that it is 99% valid and includes all this years updates. I handiest got 2 question wrong, so very excited and relieved.

Just tried HPE0-J77 question bank once and I am convinced.

by no means suspected that the issues that I had dependably fled from would be any such splendid amount of enjoyableto examine; its easy and brief approach for buying to the focuses made my planning component less worrying and helpme in getting 89% marks. All because of killexams.com dumps, I never concept i would bypass my exam yet I did enddecisively. i was going to give up exam HPE0-J77 when you consider that I wasnt nice approximately whether i would pass or not. With truely every week staying I selected to switch to Dumps for my examination making plans.

Are there good resources for HPE0-J77 study guides?

I was alluded to the killexams.com dumps as brisk reference for my examination. Really they done a very good job, I love their performance and style of working. The short-length answers were less demanding to remember. I dealt with 98% questions scoring 80% marks. The exam HPE0-J77 was a noteworthy venture for my IT profession. At the same time, I didnt contribute much time to set up my-self well for this exam.

It is great ideal to prepare HPE0-J77 exam with Actual Questions.

Its a completely beneficial platform for operating professionals like us to exercise the query financial institutionanywhere. i am very an awful lot grateful to you humans for growing any such remarkable exercise questions which turned into very useful to me within the remaining days of examinations. i've secured 88% marks in HPE0-J77 exam and the revision exercise tests helped me plenty. My proposal is that please broaden an android app in order that human beingslike us can exercise the checks whilst visiting additionally.

actual HPE0-J77 questions and accurate solutions! It justify the charge.

I passed the HPE0-J77 exam three days back, I used killexams.com dumps for preparing and I could successfully complete the exam with a high score of 98%. I used it for over a week, memorized all questions and their answers, so it became easy for me to mark the right answers during the live exam. I thank the killexams.com team for helping me with such a wonderful training material and granting success.

I need actual questions of HPE0-J77 exam.

by enrolling me for killexams.com is an possibility to get myself cleared in HPE0-J77 examination. Its a chance to get myself viathe difficult questions of HPE0-J77 exam. If I could not have the hazard to sign up for this website online i might have no longerbeen capable of clean HPE0-J77 exam. It was a glancing possibility for me that I got achievement in it so without problems and made myself so at ease becoming a member of this website. After failing in this examination i was shattered and then i found this website online that made my manner very easy.

See more HP dumps

HP0-M102 | HP2-T31 | HP2-T14 | HP2-B106 | HP0-244 | HP2-Z31 | HP3-L04 | HP0-D14 | HP0-780 | HP2-H13 | HP0-918 | HP0-S25 | HP2-Z14 | HP0-461 | HP0-719 | HP2-E38 | HP2-H18 | HP0-T01 | HP2-N44 | HP2-T17 | HP2-Z08 | HP0-697 | HPE2-W01 | HP0-M42 | HP0-J67 | HP0-264 | HP0-J49 | HP0-A01 | HP0-234 | HP2-B35 | HP0-M55 | HP2-H11 | HP0-045 | HP3-029 | HP2-T26 | HP0-427 | HP2-Q03 | HP2-E33 | HP2-E46 | HP0-451 | HPE0-J75 | HP3-X11 | HP3-X10 | HP2-K16 | HP0-144 | HP0-M98 | HP0-D04 | HP0-A116 | HP2-B104 | HP3-X09 |

Latest Exams added on brothelowner

1Z0-453 | 210-250 | 300-210 | 500-205 | 500-210 | 70-765 | 9A0-409 | C2010-555 | C2090-136 | C9010-260 | C9010-262 | C9020-560 | C9020-568 | C9050-042 | C9050-548 | C9050-549 | C9510-819 | C9520-911 | C9520-923 | C9520-928 | C9520-929 | C9550-512 | CPIM-BSP | C_TADM70_73 | C_TB1200_92 | C_TBW60_74 | C_TPLM22_64 | C_TPLM50_95 | DNDNS-200 | DSDPS-200 | E20-562 | E20-624 | E_HANABW151 | E_HANAINS151 | JN0-1330 | JN0-346 | JN0-661 | MA0-104 | MB2-711 | NSE6 | OMG-OCRES-A300 | P5050-031 |

See more dumps on brothelowner

00M-605 | BH0-002 | 1Z0-584 | 646-590 | 090-554 | C2120-800 | 920-325 | 1Z0-807 | CV0-001 | 250-352 | ISEE | GB0-280 | 7893X | 1Z0-536 | HP0-758 | VCP510-DT | HP0-752 | 1Z0-046 | 1Z0-497 | 000-R15 | CAT-120 | HP0-M19 | 000-M95 | ASC-029 | 1Z0-215 | AWMP | LOT-805 | JN0-531 | C9560-658 | C2010-940 | 000-220 | 1Z0-478 | CAT-080 | 000-226 | COG-622 | F50-536 | 000-933 | 000-582 | 000-887 | 700-410 | Maya12-A | 00M-240 | 920-336 | LOT-840 | HP2-T16 | 920-164 | 00M-647 | 920-240 | AND-402 | CLO-001 |

HPE0-J77 Questions and Answers

HP HPE0-J77 Designing HPE Backup Solutions Download Full version : http://killexams.com/pass4sure/exam-detail/HPE0-J77 QUESTION:

DUHGHPRQVWUDWLQJWRDSRWHQWLDOFXVWRPHUKRZHDV\LWLVWRUHSOLFDWHGDWDIURPRQH +3(3$56WRUH6HUYDUUD\WRDQRWKHU7KHGHPRQVWUDWLRQLVEHLQJGRQHZLWKERWK DUUD\VFRQQHFWHGWRDSDLURI6$1VZLWFKHV7KHFXVWRPHUDVNVZKDWLWZRXOGWDNHWR H[WHQGWKHLU6$1RYHUYHU\ODUJHGLVWDQFHV:KDWVKRXOG\RXUHFRPPHQGWKH\XVHWR DFFRPSOLVKWKLV" $PXOWLPRGHUHSOLFDWLRQ % ZDYHGLYLVLRQPXOWLSOH[LQJ & )&,3URXWLQJ ' ORZEDQGZLGWKUHSOLFDWLRQ Answer: & QUESTION: $FXVWRPHU¶VEDFNXSVROXWLRQSHUIRUPVGDLO\IXOOEDFNXSVRIWKHHQYLURQPHQW7KH FXVWRPHULVDVNLQJIRUDGLIIHUHQWVROXWLRQGXHWRWKHDPRXQWRIWLPHLWWDNHVRQDGDLO\ EDVLV7KH\RQO\QHHGWREHDEOHWRNHHSFRSLHVRIUHFHQWO\FKDQJHGILOHVWRUHVWRUHLID SUREOHPRFFXUV)XOOEDFNXSVZLOOFRQWLQXHWREHSHUIRUPHGRQZHHNHQGGD\VEXWWKH FXVWRPHUZDQWVDVROXWLRQIRUQRQZHHNHQGGD\V:KLFKEDFNXSVROXWLRQKHOSV DFFRPSOLVKWKLV" $ DUFKLYHDQGEDFNXS % LPDJHEDVHG & GLIIHUHQWLDO ' ILOHEDVHG Answer: & QUESTION: $EDFNXSVFKHGXOHLVVHWXSZKHUHD)XOOEDFNXSLVWDNHQHYHU\6XQGD\ZLWKGLIIHUHQWLDO EDFNXSVWDNHQHYHU\GD\WKHUHDIWHUGXULQJWKHZHHN7KDWLVWKHLPSDFWRQWKHDELOLW\D IXOOUHVWRUHRQ)ULGD\LI7XHVGD\¶VWDSHLVORVW" $ 7XHVGD\ VWDSHFDQEHUHFUHDWHGIURPWKHSDULW\GDWDRQWKHRWKHUWDSHV % 7KHUHLVQRLPSDFW2QO\6XQGD\ VDQG7KXUVGD\ VWDSHVDUHQHHGHG &$IXOOUHVWRUHLVQRWSRVVLEOHDVDOOWDSHVDUHQHHGHG ' 7XHVGD\VWDSHFDQEHUHFUHDWHGEDVHGRQWKHPHWDGDWDLQWKHEDFNXSGDWDEDVH Answer: % QUESTION: :KLFKFDSDELOLW\LVDYDLODEOHWRXVHZLWK+3(6WRUH(YHUWDSHOLEUDULHVDORQJZLWK VRIWZDUHGULYHUVWKDWSURYLGH03,2" $ SDUWLWLRQLQJRIWDSHOLEUDULHV % EDFNXSVWKURXJK)LEUH&KDQQHO & DGYDQFHGSDWKIDLORYHU ' RIIORDGLQJEDFNXSVWRWDSH Answer: & QUESTION: '5$*'523 0DWFKHDFKPDQDJHPHQWWRROWRWKHFRUUHFW+3(6WRUDJHSURGXFW Answer: ([KLELW QUESTION: :KLFKVWDWHPHQWLVFRUUHFWDERXWHQDEOLQJGDWDDWUHVWRULQIOLJKWHQFU\SWLRQRQD SK\VLFDO+3(6WRUH2QFHDSSOLDQFH" $ (QFU\SWLRQLVHQDEOHGE\GHIDXOW % (QFU\SWLRQLVQRWSRVVLEOHRQ+3(6WRUH2QFH & (QFU\SWLRQLVDIXQFWLRQRIWKHEDFNXSDSSOLFDWLRQ ' 7KH+3(6WRUH2QFH6HFXULW\3DFNOLFHQVHPXVWEHLQVWDOOHG Answer: ' QUESTION: $&XVWRPHUKDVWZRVLWHVWKDWDUHPLOHVNPDSDUW(DFKVLWHLVSHUFHQW YLUWXDOL]HGDQGKDVLGHQWLFDOVWRUDJHDQGVHUYHULQIUDVWUXFWXUHUXQQLQJDFWLYHDFWLYH HQYLURQPHQWZLWKDUUD\EDVHGUHSOLFDWLRQ7KHFXVWRPHUQHHGVDVROXWLRQWKDWHQDEOHV WKHPWRUHFRYHUHLWKHUVLWHZLWKPLQLPDOLQSXWIURPWKHLU,7WUDPVZKLOHPHHWLQJWKHLU WZRKRXU572DQGPLQXWHV5326/$V:KDWVKRXOG\RXUHFRPPHQGWRLPSURYHWKLV FXVWRPHU¶VFXUUHQWLQIUDVWUXFWXUH" $ 90ZDUH6LWH5HFRYHU\0DQDJHU % 90ZDUHY&HQWHU2SHUDWLRQV0DQDJHU & +3(3$55HPRWH&RS\6RIWZDUH ' 90ZDUHY5HDOL]HDXWRPDWLRQ Answer: $ 'PS.PSFFYBNTWJTJUIUUQLJMMFYBNTDPN .LOO\RXUH[DPDW)LUVW$WWHPSW*XDUDQWHHG

HP HPE0-J77 Exam (Designing HPE Backup Solutions) Detailed Information

HPE0-J77 - Designing HPE Backup Solutions


HPE0-J77 Test Objectives


Print this page
Exam ID HPE0-J77
Exam type Proctored
Exam duration 1 hour 15 minutes
Exam length 50 questions
Passing score 65%
Delivery languages English, Simplified Chinese, Japanese
Related certifications
  • HPE ASE - Storage Solutions Architect V2
  • HPE ASE - Storage Solutions Architect V2 - upgrade from EMC
Supporting resources These recommended resources help you prepare for the exam:
  • 01059534: Designing HPE Backup Solutions, Rev 16.11
Register for this Exam You need an HPE Learner ID and a Pearson VUE login and password. No reference material is allowed at the testing site. This exam may contain beta test items for experimental purposes.During the exam, you can make comments about the exam items. We welcome these comments as part of our continuous improvement process.

Exam description

This exam tests your skills and knowledge of technologies, concepts, and strategies of effective Enterprise Backup Solutions. The exam includes questions on identifying the correct components for a backup and recovery solution. The exam tests your understanding of HPE's BURA solutions to provide customers with complete data protection. This exam tests your competency level and understanding of HPE StoreOnce Backup Systems and BURA best practices, configuration guidelines, and recommended configurations.

Ideal candidate for this exam

Typical candidate is a presales and solutions architects who wants to earn their HPE - Storage Solutions Architect V2 certification. We recommend candidates have a minimum of one (1) year of experience in storage technologies and can identify and define business requirements and then design enterprise scope, complex storage solutions to meet those needs.

Exam contents

This exam has 50 questions. Here are types of questions to expect:

Advice to help you take this exam

Objectives

This exam validates that you can: Sections/Objectives
24%

Differentiate and apply foundational storage architectures and technologies

  • Describe backup systems technology
  • Describe data availability methods and technologies
  • Describe and differentiate between replication, backup and archiving
40%

Plan and design HPE storage solutions

  • Discover backup solution opportunities
  • Plan and design the backup solution
  • Size the backup solution
  • Review and validate the backup solution proposal
  • Present the backup solution to the customer
17%

Performance-tune, optimize, and upgrade HPE storage backup solutions

  • Identify and compare the existing backup solution design to the best practices documentation
  • Optimize and performance-tune the storage backup solution
19%

Manage, monitor, administer, and operate HPE storage backup solutions

  • Install, configure, set up, and demo proof-of-concept for HPE storage backup solutions
  • Demonstrate data replication tasks for proof-of-concept
  • Demonstrate external array storage for proof-of-concept
  • Demonstrate backup and archival storage in a single-site environment for proof-of-concept

Sample questions

Sample questions are a preview of what you can expect on the actual exam. They help you become familiar with the exam format and complexity. These sample questions are similar to actual exam questions, but do not actually appear on the exam. To view sample questions,  print or download this page.

Related pages

Connect with us

jQuery(document).ready(function () { var data = ko.mapping.fromJS({"RelatedCertifications":[{"ProgramId":"ASE-StorSolArcV2","ModifiedProgramId":"ASE-StorSolArcV2","Name":"HPE ASE - Storage Solutions Architect V2","IsActive":true,"EntityType":"Certification","Id":"877e5c41-22f4-e411-80d0-00215a92256b","ShowOnWeb":true,"IsAvailableInLanguage":false},{"ProgramId":"ASE-StorSolArcV2-u1","ModifiedProgramId":"ASE-StorSolArcV2-u1","Name":"HPE ASE - Storage Solutions Architect V2 - upgrade from EMC","IsActive":true,"EntityType":"UpgradePath","Id":"765b4d0b-7aa3-e511-80c9-00215a9b0e48","ShowOnWeb":true,"IsAvailableInLanguage":false}],"OptionGroups":[{"Key":"Option 1","Value":[{"ProgramId":"01059534","ModifiedProgramId":"01059534","Name":"01059534: Designing HPE Backup Solutions, Rev 16.11","IsActive":true,"EntityType":"Course","Id":"9962be75-5d4b-e511-80d7-00215a9225dd","ShowOnWeb":true,"IsAvailableInLanguage":false}]}],"SuggestedCourses":null,"SuggestedCurricula":null,"DeliveryLanguages":"English, Simplified Chinese, Japanese","Duration":"1 hour 15 minutes ","SecondParagraph":null,"ThirdParagraph":null,"ExamType":"Proctored","ItemDetails":{"WhoShouldTake":"Typical candidate is a presales and solutions architects who wants to earn their HPE - Storage Solutions Architect V2 certification. We recommend candidates have a minimum of one (1) year of experience in storage technologies and can identify and define business requirements and then design enterprise scope, complex storage solutions to meet those needs.","Hours":1,"Minutes":15,"PassingScore":65,"DeliveryLanguages":[{"Key":"ce691368-3898-4645-86e6-30cead426894","Value":"English"},{"Key":"f775c246-cc33-4fb0-97bc-619e515ef697","Value":"Simplified Chinese"},{"Key":"ed03e55f-1c06-4caa-a54a-784922c912a9","Value":"Japanese"}],"Options":[{"Name":"Option 1","Items":[{"ItemType":3,"Name":"Designing HPE Backup Solutions, Rev 16.11","Id":"01059534"}]}],"RelatedCertifications":[{"Key":"ASE-StorSolArcV2","Value":"HPE ASE - Storage Solutions Architect V2"}],"RelatedUpgradePaths":[{"Key":"ASE-StorSolArcV2-u1","Value":"HPE ASE - Storage Solutions Architect V2 - upgrade from EMC"}],"AdditionalStudyMaterial":[],"ReplacedBy":[],"Replaced":[{"Key":"HP0-J63","Value":"Designing HP Backup Solutions"}],"TipsForTaking":"","Questions":50,"ObjectiveStatement":"This exam validates that you can:","Objectives":[{"SectionNumber":1,"SectionObjectives":"Differentiate and apply foundational storage architectures and technologies","PercentOf":"24"},{"SectionNumber":2,"SectionObjectives":"Plan and design HPE storage solutions","PercentOf":"40"},{"SectionNumber":3,"SectionObjectives":"Performance-tune, optimize, and upgrade HPE storage backup solutions","PercentOf":"17"},{"SectionNumber":4,"SectionObjectives":"Manage, monitor, administer, and operate HPE storage backup solutions","PercentOf":"19"}],"QuestionTypes":[{"Key":"d46ab1c9-094f-429f-9025-892a72fc7f39","Value":"Drag-and-drop"},{"Key":"659bb56d-4b0d-4b10-b06c-6e3d61688f37","Value":"Multiple choice (single response)"},{"Key":"d73fa45d-e5ba-4e06-8bdb-6a09c06e592d","Value":"Multiple choice (multiple responses)"},{"Key":"b0031aac-26ed-4c6a-8118-68ba54e9385b","Value":"Matching"},{"Key":"1b5f7168-1acb-47dc-a3d0-4e089242ac3f","Value":"Multiple choice (single response), scenario based"},{"Key":"b165c258-ec41-4ddb-8639-3cf41d62ab57","Value":"Multiple choice (multiple responses), scenario based"}],"SampleQuestionDescription":"Sample questions are a preview of what you can expect on the actual exam. They help you become familiar with the exam format and complexity. These sample questions are similar to actual exam questions, but do not actually appear on the exam.","SampleQuestions":[{"Sequence":1,"Question":"What does HPE recommend be included with all HPE 3PAR StoreServ 8000 storage systems?","Answers":[{"Key":"HPE StoreOnce VSA","Value":false},{"Key":"HPE StoreOnce Appliance","Value":true},{"Key":"HPE Remote Copy Software","Value":false},{"Key":"HPE Data Protector Software","Value":false}],"ReferenceMaterials":[]},{"Sequence":2,"Question":"A company's marketing group works with images and has very large files. They actively promote a product for a year, with an additional one-to-three month period of coexistence with the follow-on product. After that they keep the files indefinitely for reference use and an occasional retro ad. Marketing requires rapid access to the current materials and economical storage for older campaigns.Which data protection method will allow Marketing to meet their compliance objectives?","Answers":[{"Key":"local replication","Value":false},{"Key":"remote replication","Value":false},{"Key":"backup","Value":false},{"Key":"archiving","Value":true}],"ReferenceMaterials":[]},{"Sequence":3,"Question":"What must be considered when sizing an upgrade of a 4 TB HPE StoreOnce VSA solution to a 10 TB solution? (Select two.)","Answers":[{"Key":"Minimum IOPS to achieve stated throughput are doubled.","Value":true},{"Key":"Memory requirements are doubled.","Value":false},{"Key":"Network connectivity must be upgraded to 10 Gb/s.","Value":false},{"Key":"Twice the amount of vCPUs are required.","Value":true},{"Key":"Number of NICs per host must be raised.","Value":false}],"ReferenceMaterials":[]},{"Sequence":4,"Question":"A customer needs a maximum capacity of 3 TB and a throughput of 950 MB/s for the backup-to-disk solution to achieve their backup and restore goals. Which HPE StoreOnce Backup System with use of Catalyst should you size?","Answers":[{"Key":"HPE StoreOnce 2700","Value":false},{"Key":"HPE StoreOnce 2900","Value":false},{"Key":"HPE StoreOnce 4500","Value":true},{"Key":"HPE StoreOnce 6500","Value":false}],"ReferenceMaterials":[]},{"Sequence":5,"Question":"A tape drive has been replaced in a customer's HPE StoreEver tape library.  You need to verify that the firmware version is compliant with the customer documentation.How should you accomplish this?","Answers":[{"Key":"Use HPE Library and Tape Tools","Value":true},{"Key":"The version is determined by the library.","Value":false},{"Key":"Read the version from the tape label.","Value":false},{"Key":"Use the HPE StoreOnce management console.","Value":false}],"ReferenceMaterials":[]}],"RegistrationUrl":"http://www.pearsonvue.com/hpe","RegistrationInstructions":"You need an HPE Learner ID and a Pearson VUE login and password.","TestingDisclaimer":"No reference material is allowed at the testing site. This exam may contain beta test items for experimental purposes.During the exam, you can make comments about the exam items. We welcome these comments as part of our continuous improvement process.","IncludeSecondParagraph":false,"IncludeThirdParagraph":false,"IsAruba":false,"JapanInactiveDate":null,"LaInactiveDate":null,"ApjInactiveDate":null,"AmsInactiveDate":null,"EmeaInactiveDate":null,"ProgramId":"HPE0-J77","Name":"Designing HPE Backup Solutions","EntityType":2,"Type":{"Key":"21550bfb-8845-4732-9350-2f1dd8e32cfc","Value":"HP0-xxx – Proctored exam taken at dedicated testing center"},"ReleaseStatus":{"Key":"9add30ae-a216-4790-9ea6-262670e0862b","Value":"Active"},"Description":"This exam tests your skills and knowledge of technologies, concepts, and strategies of effective Enterprise Backup Solutions. The exam includes questions on identifying the correct components for a backup and recovery solution. The exam tests your understanding of HPE's BURA solutions to provide customers with complete data protection. This exam tests your competency level and understanding of HPE StoreOnce Backup Systems and BURA best practices, configuration guidelines, and recommended configurations.","OriginalLaunchDate":"2016-03-01T00:00:00","MetadataKeywords":"HPE, Hewlett Packard Enterprise, HP, Hewlett Packard, Hewlett-Packard, Partner Ready, Partner Ready Certification and Learning, certify, certification, exam, test, HPCP, instructor led, ILT, Designing, Backup, Solutions, ASE","MetadataDescription":"Overview of the HP0-J77 Designing HPE Backup Solutions exam, including exam description, details, and objectives. Links to supporting courses, associated certifications, additional study materials, and exam registration."},"IsPublished":true,"Version":4.0,"Level":null,"LaunchDate":"2017-03-15T00:06:03.093","ModifiedProgramId":"HPE0-J77","IsTranslated":true,"IsDeliveryReady":true,"IsForEmployee":false,"BaseUrl":"","BaseRegisterUrl":"","PublicSiteUrl":"https://certification-learning.hpe.com/tr","TrainingCalendarUrl":"https://certification-learning.hpe.com/tr/TrainingCalendar","HpLearnerIdUrl":"https://certification-learning.hpe.com/tr/learner_id.html","PersonVueUrl":"http://www.pearsonvue.com/hpe","LearningCenterAssistKitUrl":"https://certification-learning.hpe.com/tr/assist_kit/index.html","LearningCenterUrl":"https://certification-learning.hpe.com/tr/learning_center.html","CourseRegisterUrl":"https://hpe-external.sabacloud.com/Saba/Web_spf/HPE/common/searchresults/{0}/LEARNINGEVENT%2COFFERINGTEMPLATE%2CCERTIFICATION%2CCURRICULUM%2COFFERING%2CPACKAGE","CertificationRegisterUrl":"https://hpe-external.sabacloud.com/Saba/Web_spf/HPE/common/searchresults/{0}/LEARNINGEVENT%2COFFERINGTEMPLATE%2CCERTIFICATION%2CCURRICULUM%2COFFERING%2CPACKAGE","CurriculumRegisterUrl":"https://hpe-external.sabacloud.com/Saba/Web_spf/HPE/common/searchresults/{0}/LEARNINGEVENT%2COFFERINGTEMPLATE%2CCERTIFICATION%2CCURRICULUM%2COFFERING%2CPACKAGE","SelectedMenu":"certifications","Controller":"DataCard","SiteLanguage":{"id":"fbd9cabd-d808-e711-bd2b-00090ffe0001","text":"English","disabled":false,"data":null},"AvailableLanguages":[{"id":"fbd9cabd-d808-e711-bd2b-00090ffe0001","text":"English","disabled":false,"data":null},{"id":"fcd9cabd-d808-e711-bd2b-00090ffe0001","text":"日本語","disabled":false,"data":null}],"LanguageCode":"en","CountryCode":"us","IsSoftware":false,"SoftwareMessage":null,"RelatedPages":[]}, customKoMapping); var viewModel = new HP.ViewModels.BaseExternalSiteModel(data); ko.applyBindings(viewModel); }); Learning resources that were developed before the Hewlett-Packard Company separation might contain some content and brand elements that have not been updated for Hewlett Packard Enterprise. Learning resources with the highest usage are updated.


References:


Download Hottest Pass4sure Certification Exams - CSCPK
Complete Pass4Sure Collection of Exams - BDlisting
Latest Exam Questions and Answers - Ewerton.me
Pass your exam at first attempt with Pass4Sure Questions and Answers - bolink.org
Here you will find Real Exam Questions and Answers of every exam - dinhvihaiphong.net
Hottest Pass4sure Exam at escueladenegociosbhdleon.com
Download Hottest Pass4sure Exam at ada.esy
Pass4sure Exam Download from aia.nu
Pass4sure Exam Download from airesturismo
Practice questions and Cheat Sheets for Certification Exams at linuselfberg
Study Guides, Practice questions and Cheat Sheets for Certification Exams at brondby
Study Guides, Study Tools and Cheat Sheets for Certification Exams at assilksel.com
Study Guides, Study Tools and Cheat Sheets for Certification Exams at brainsandgames